PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P25990_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 152aa    MW: 16984.2 Da    PI: 7.1635
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P25990_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.71.1e-142411857
                           HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            F+ +r++   ++ +LA++lgL+ +qV vWFqNrRa++k+
  GSMUA_Achr7P25990_001  2 SFQDERKLESGRKVHLATELGLDPKQVAVWFQNRRARHKN 41
                           69************************************95 PP

2HD-ZIP_I/II95.55.4e-312761791
            HD-ZIP_I/II 17 sFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
                           sF+ e+kLe+ rKv+la+eLgl+p+qvavWFqnrRAR+k+kq+E+ y++Lk a+da++ e+++Lekev +L+ +l
  GSMUA_Achr7P25990_001  2 SFQDERKLESGRKVHLATELGLDPKQVAVWFQNRRARHKNKQVEEAYAKLKMAHDAVVFEKCHLEKEVFKLKGKL 76
                           8*9********************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.945142IPR001356Homeobox domain
SMARTSM003893.6E-4146IPR001356Homeobox domain
CDDcd000866.39E-11243No hitNo description
PfamPF000464.5E-12241IPR001356Homeobox domain
SuperFamilySSF466891.37E-12243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-14248IPR009057Homeodomain-like
PRINTSPR000311.3E-51322IPR000047Helix-turn-helix motif
PROSITE patternPS0002701740IPR017970Homeobox, conserved site
PRINTSPR000311.3E-52238IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MSFQDERKLE SGRKVHLATE LGLDPKQVAV WFQNRRARHK NKQVEEAYAK LKMAHDAVVF  60
EKCHLEKEVF KLKGKLLEAE AEIRKLSLGA SGPGASGSNA ERGGSSPSSS LSTVSHHPLV  120
GEFGVEGEAD LMNIQEYNFN NYMMEWANFY GV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13442RRARHKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411026.11e-110PREDICTED: homeobox-leucine zipper protein HOX12-like
SwissprotQ7XI858e-45HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLM0TKT51e-110M0TKT5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P25990_0011e-109(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.14e-33homeobox protein 40